Titanium Dioxide Acetic Acid Citric Acid Sodium Hydroxide Oxalic Acid Ethyl Acetate

All Categories

Encyclopedia |

Market Inquiry|

Supplier|

About Globalchemx

GIP (HUMAN)

CAS No.: 100040-31-1

Formula: C226H338N60O66S

Molecular Weight: 4983.52932

Suppliers: All(0) China Suppliers(0) Products(0)

Description
Basic Info
Safety Info
Price
Related Product
Supplier Reference

What is GIP (HUMAN)

**Introduction to GIP (HUMAN)** GIP (HUMAN) is a cutting-edge biopharmaceutical product designed to harness the therapeutic potential of the human gastric inhibitory polypeptide (GIP). As a key metabolic hormone, GIP plays a vital role in glucose homeostasis, insulin secretion, and fat metabolism, making it a promising target for metabolic disorders like type 2 diabetes and obesity. Developed using advanced recombinant DNA technology, GIP (HUMAN) offers high purity and bioactivity, ensuring optimal efficacy in clinical applications. By modulating GIP receptor pathways, this innovative therapy aims to improve glycemic control, support weight management, and enhance overall metabolic health. Backed by rigorous research, GIP (HUMAN) represents a breakthrough in precision medicine for metabolic diseases.

Preparation Process: To prepare GIP (human), synthesize the 42-amino acid peptide (Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln) using solid-phase peptide synthesis (SPPS) with Fmoc chemistry. Cleave the peptide from the resin using TFA, then purify via reverse-phase HPLC (C18 column, acetonitrile/water gradient). Lyophilize the purified product and confirm identity by mass spectrometry. For biological use, ensure endotoxin-free conditions and sterile filtration. Store at –20°C in lyophilized form or in PBS at 4°C for short-term use. Optimize folding if necessary.

Usage Scenarios: GIP (glucose-dependent insulinotropic polypeptide) is a hormone secreted by K cells in the small intestine in response to nutrient intake, particularly glucose and fat. Its primary role is to enhance insulin secretion from pancreatic β-cells in a glucose-dependent manner, aiding postprandial glucose regulation. GIP also promotes lipid storage in adipocytes by stimulating lipoprotein lipase activity. Additionally, it influences bone metabolism by inhibiting bone resorption. In research, GIP analogs and antagonists are studied for their potential in managing metabolic disorders like type 2 diabetes and obesity. GIP receptor agonists are being explored for their dual effects on glycemic control and weight regulation.

GIP (HUMAN) Basic Info

Chemical Name GIP (HUMAN)

Synonyms GIP;GIP (HUMAN);GIP (Total);GIP (active);M.W. 4983.59 C226H338N60O66S;GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;Gastric inhibitorypolypeptide (human) (9CI);Gastric inhibitory polypeptide human, ≥95% (HPLC)

CAS No. 100040-31-1

Molecular Formula C226H338N60O66S

Molecular Weight 4983.52932

PSA -

LogP -

Safely Info

RTECS -

Hazard Class -

Safety Statements -

HS Code -

WGK Germany -

Packing Group -

RIDADR -

Risk Statements -

Hazard Codes -

Caution Statement -

Hazard Declaration -

Symbol -

Signal Word -

GIP (HUMAN) Price

Here is a rough price range for the chemical product "GIP (HUMAN)" in the listed countries. Note that these ranges are approximate and may vary based on suppliers, quantities, and market conditions:

1. **United States**: $100 - $500 per unit
2. **China**: $50 - $300 per unit
3. **Russia**: $80 - $400 per unit
4. **Germany**: $120 - $600 per unit
5. **India**: $40 - $250 per unit
6. **Japan**: $150 - $700 per unit
7. **Brazil**: $70 - $350 per unit
8. **South Korea**: $100 - $500 per unit
9. **Philippines**: No results
10. **United Kingdom**: $130 - $650 per unit
11. **France**: $120 - $600 per unit
12. **Mexico**: $60 - $300 per unit
13. **Canada**: $100 - $500 per unit
14. **South Africa**: $50 - $250 per unit
15. **Egypt**: No results
16. **Turkey**: $70 - $350 per unit
17. **Thailand**: $60 - $300 per unit
18. **Indonesia**: No results

*Prices are estimates and may vary significantly depending on the source and market conditions.*